SIP M. Munakata Internet-Draft S. Schubert Intended status: Standards Track T. Ohba Expires:May 15, 2008 NTT November 12,August 22, 2007 NTT February 18, 2008 UA-Driven Privacy Mechanism for SIPdraft-ietf-sip-ua-privacy-00draft-ietf-sip-ua-privacy-01 Status of this Memo By submitting this Internet-Draft, each author represents that any applicable patent or other IPR claims of which he or she is aware have been or will be disclosed, and any of which he or she becomes aware will be disclosed, in accordance with Section 6 of BCP 79. Internet-Drafts are working documents of the Internet Engineering Task Force (IETF), its areas, and its working groups. Note that other groups may also distribute working documents as Internet- Drafts. Internet-Drafts are draft documents valid for a maximum of six months and may be updated, replaced, or obsoleted by other documents at any time. It is inappropriate to use Internet-Drafts as reference material or to cite them other than as "work in progress." The list of current Internet-Drafts can be accessed at http://www.ietf.org/ietf/1id-abstracts.txt. The list of Internet-Draft Shadow Directories can be accessed at http://www.ietf.org/shadow.html. This Internet-Draft will expire onMay 15, 2008.August 22, 2007. Copyright Notice Copyright (C) The IETF Trust (2007). Abstract To withhold a user's identity and related information, RFC 3323 defines a Privacy mechanism for SIP, which requires the use of an privacy service. This document proposes a new privacy mechanism that a user agent can facilitate to conceal privacy-sensitive information without the need for aid from a privacy service. Table of Contents 1. Introduction . . . . . . . . . . . . . . . . . . . . . . . . . 3 2. Terminology . . . . . . . . . . . . . . . . . . . . . . . . . 4 3. Concept of Privacy . . . . . . . . . . . . . . . . . . . . . . 4 4.Use Cases . . . . . . . . . . . . . . . . . . . . . . . . . . 5 5.Requirements . . . . . . . . . . . . . . . . . . . . . . . . . 56.5. Treatment ofUser Privacy RelatedPrivacy-Sensitive Information . . . . . . . . . . 56.1.5.1. Anonymous URI and Display-Name . . . . . . . . . . . . . .. . . . . . . . 6 6.2.5 5.2. Anonymous IP Address . . . . . . . . . . . . . . . . . . . 67.6. User Agent Behavior . . . . . . . . . . . . . . . . . . . . . 77.1.6.1. Generating Anonymous Message . . . . . . . . . . . . . . . 77.2.6.2. Indication tomaintainMaintain Privacy . . . . . . . . . . . . . . 78.7. Proxy Behavior . . . . . . . . . . . . . . . . . . . . . . . . 89.8. Security Considerations . . . . . . . . . . . . . . . . . . . 810.9. IANA Considerations . . . . . . . . . . . . . . . . . . . . . 811.10. References . . . . . . . . . . . . . . . . . . . . . . . . . . 811.1.10.1. Normative References . . . . . . . . . . . . . . . . . . . 811.2.10.2. Informative References . . . . . . . . . . . . . . . . . . 9 Authors' Addresses . . . . . . . . . . . . . . . . . . . . . . . . 9 Intellectual Property and Copyright Statements . . . . . . . . . . 10 1. Introduction Privacy is defined inthis document[RFC3323] as the withholding of the identity of a person (and related personal information) from destination(s) of messages and/or intermediaries handling these messages inaan exchange of SIP (Session Initiation Protocol) [RFC3261]dialog.communications. In SIP, identity is most commonly carried in the form of a SIP URI and an optionaldisplay name,display-name, which commonly appear in the To, From and other header fields of SIP requests and responses. There are numerous other places in SIP messages in which identity- related information can be revealed. For example, the Contact header field contains a SIP URI. Moreover, information in the Record-Route and Via headers could inadvertently reveal something about the originator of a message.To provide privacy, [RFC3323]RFC 3323 definesaprivacymechanismmechanisms for SIP,which was thenbased on techniques available at thebest current practicetime of publication. Some of these mechanisms rely on the use of a separate privacy service tomaintain privacy.remove sensitive information from messages sent by a user agent before forwarding those messages to the final destination. Since then, numerous SIP extensions have been proposed and standardized. Some of those seem to enable a user agent to withhold its user's identity and related information without dependency on privacy services, which was not possible whenRFC3323RFC 3323 was defined.Some aspectA number of issues have been identified with the mechanisms defined in RFC 3323, especiallyits dependencywith mechanisms that depend on a privacyservice to provide privacy, seems to cause some issues, which we hope that we can resolve with this specification. Some of the issues identified with the RFC 3323 are shown below.service. 1. There is no assurance that a privacy service exists in the signaling path. 2. There is no way that the user requesting the privacy can figure out that the privacy function was properly executed. 3. A privacy service that modifies a Call-IDin the establishment of the original dialogmust be present in the signaling path ofthe subsequent request such as REFER. If a privacy service anonymizes a Call-ID and the anonymized Call-ID is referenced in aany subsequentSIP message for the purpose of a call-back or a call replacement,requests that carry that Call-ID. For requests within theprivacy service needs tosame dialog this can bein a signaling path to replaceachieved using theanonymized Call-ID withrecord-route mechanism. For requests outside theoriginal Call-ID appropriately, regardless of being inside/outsidedialog that carry thedialog.Call-ID in a Replaces, Join or Target- Dialog header field, for example, there is no defined mechanism. 4. To map the referenced dialog to a dialog attempt invoked by REFER, for example, the privacy service needs to retain the correspondence relation between original information and modified information beyond the actual dialog duration of the referenced dialog. To solve the problems, this document proposes a new privacy mechanism in which a user agentexecutescontrols all the privacy functions on its own utilizing SIP extensions such as GRUU (Globally Routable User Agent URIs)[I-D.ietf-sip-gruu] and TURN (Traversal Using RelayNAT)[I-D.rosenberg-midcom-turn].NAT)[I-D.ietf-behave-turn]. 2. Terminology The key words "MUST", "MUST NOT", "REQUIRED", "SHALL", "SHALL NOT", "SHOULD", "SHOULD NOT", "RECOMMENDED", "MAY", and "OPTIONAL" in this document are to be interpreted as described in [RFC2119].3. Concept of Privacyprivacy-sensitive information: Theconcept of privacy in this document means the concealing ofinformation thatrelates to a user,identifies auser, and belongs to a user,user who sends the SIP message, as well as the supplementary information that can be used to guess the user's identity. 3. Concept of Privacy Thescopeconcept of privacy in this documentis to withholdmeans the concealing of the identity of a user and supplementary information. The scope of this document is to withhold the privacy-sensitive information of the user who sends the SIP message from other users and intermediaries handling the message. The protection of network privacy (e.g., topology hiding) is outside the scope of this document.User-privacy-relatedPrivacy-sensitive information includesdisplay namedisplay-name and URI in a From header that can reveal the user's name and affiliation (e.g., company name), contact information in a Contact header that is used to communicate with theuser,user's UA, an IP address in an SDP (Session Description Protocol)[RFC4566] that tells the location of a user'sterminalUA and can be used to establish a connection. A host name in Call-ID is also regarded asuser-privacy-relatedprivacy-sensitive information because it may reveal the user's domain name. Privacy-sensitive information is divided into two types,user- insertedinformation inserted by the user's UA andnetwork-inserted information.information inserted by other SIP entities (e.g., proxies, B2BUAs). A user agent can maintain privacy of theuser-insertedUA-inserted information by itself. On the other hand, regarding thenetwork-inserted information,information inserted by other entities, a user agent can insert a privacy flag and request intermediaries not to add theuser-privacy-relatedprivacy-sensitve information. 4.Use Cases The following are the use cases from the viewpoint of privacy. Case 1: User privacy is required and a user agent can anonymize all of the user-inserted privacy-related information by itself. Case 2: User privacy is required but a user agent cannot anonymize the user-inserted privacy-related information all by itself. Case 3: User privacy is not required. The user does not want privacy at all and would like to reveal his/her identity. Note that Case 2 is based on the premise that the user agent has limited capabilities and it cannot find a GRUU or TURN server. Case 2 is outside the scope of this document. 5.Requirements Thefollowing arerequirementsto cover the use cases infor theprevious section.UA-driven privacy mechanism are as follows: Req 1: A user agent MUST be able to send a SIP request that is fully anonymized. This is, any headers and body inserted by theUAuser agent does not jeopardize user privacy. Req 2: It MUST be possible for a user agent to indicate to downstream entities that a user is requesting privacy. Req 3: When privacy is requested, a proxy SHOULD honor the request and only add information necessary to route the call while withholding any sensitive information that may reveal anything about the user if possible. Req 4: Mechanism defined here MUST be backward compatible with the pre-existing privacy mechanism already in place.6.5. Treatment ofUser Privacy RelatedPrivacy-Sensitive Information Except by means of a privacy service, RFC 3323 does not provide means to obscure two important pieces of information about the user agent, which are a URI used to exchange signaling (Contact, From, for example), andanIPaddressaddress(es) used to exchange media. RFC 3323 recommends to set sip:anonymous@anonymous.invalid as a SIP URI in a From header when user privacy is required. Although, the From header field URI may need to be an anonymous but functional URI. For example, a mechanism of SIP-Identity [RFC4474] requires a functional From header even if it is anonymous. With the use of GRUU [I-D.ietf-sip-gruu] and TURN[I-D.rosenberg-midcom-turn], UA[I-D.ietf-behave-turn], a user agent can now obtainURIURI(s) and IPaddressaddress(es) for media that arefunctional, which are usable to exchange either signaling or media while providing privacy. 6.1.functional yet anonymous, in that they do not identify the user agent. 5.1. Anonymous URI and Display-Name A user agent wanting to obtain functional anonymous URI SHOULD support and SHOULD utilize theGlobal Routable User Agent URI (GRUU)GRUU mechanism. By sending a REGISTER request requesting GRUU, the UA can obtain an anonymous URI, which can later be used forFrom,Contactand other headers where the URI of the originator is needed.header. The detailed process on how a user agent obtains a GRUU is described in [I-D.ietf-sip-gruu]. If the Registrar supports GRUU and returns a REGISTER response, the user agent SHOULD search within the REGISTER response for a "temp-gruu" URI parameter, which provides the desired privacy property. If the "temp-gruu" URI parameter and value exist within the REGISTER response, the user agent SHOULD use the value of the "temp-gruu" as an anonymous URI representing theoriginator.user agent. This URI SHOULD be used for Contactand From, for example, wherever the originator of the URI is required.header. The user agentsettingusing the "temp-gruu" as aGRUU SHOULDcontact URI is RECOMMENDED to set "Anonymous" as adisplay namedisplay-name in any header where thedisplaydisplay- name of the originator is set. That indicates the anonymity of the request to intermediaries that may invoke some services based on the anonymity of the call. The temp-gruu alone is not sufficient to invoke such service because GRUU is merely a URI that is a sequence of strings and digits with no explicit semantics to indicate that it is an anonymous URI. If there is no "temp-gruu" URI parameter in the 200 response to the REGISTER request, a user agent SHOULD NOT proceed with its anonymization process, unless something equivalent to "temp-gruu" is provided through some administrative means. Note: How to obtain an anonymous URI for From and any headers other than the Contact is FFS. It is RECOMMENDED that user agent consult the user before sending a request without a functional anonymous URI when privacy is request from the user.6.2.5.2. Anonymous IP Address It is assumed that a user agent is either manually or automatically configured through means such as a configuration framework [I-D.ietf-sipping-config-framework] with the address of one or more STUN relay servers. Two IP addresses are needed to maintain privacy, one to be used in signaling such as in a Via header, another to be used in SDP for media. A user agent that is not provided with a functional anonymous IP address through some administrative means, SHOULD obtain a relayed address (IP address of the media relay) for use in SDP, derived from a STUN [I-D.ietf-behave-turn] relay server using the STUNRelay Usage[I-D.rosenberg-midcom-turn],relay usage, which allows a STUN server to act as a media relay. Note: A relayed IP address may be used for a Via header, but some commented that is not an appropriate to be used for signaling. There was a comment about the IP address in Via being stripped by the proxy, but that would require that a proxy compliant to this specification is in the signaling path.7.6. User Agent Behavior A user agent fully compliant with this document SHOULD obscure or conceal all theuser-inserted privacy-relatedUA-inserted privacy-sensitive information in SIP requests and responses when user privacy is requested. Section7.16.1 describes how to generate an anonymous message at a user agent. When a user agent generates an anonymous message based on this specification, it SHOULD set an indication to tell intermediaries not to addor modify user-privacy-relatedprivacy-sensitive information. Section7.26.2 describes more about this.7.1.6.1. Generating Anonymous Message The two pieces of information that a user agent needs to obscure while sustaining its purpose and functionality are the URI and IP address used for establishing a media/signaling session. Instructions on how to obtain an functional anonymous URI and IP address are given in Section6.15.1 and6.2,5.2, respectively. For anonymizing any headers and information in a SIP message, the user agent SHOULD follow the instructions in this document. Note: Instructions to treat each SIP header/parameter in generating an anonymous SIP messageSIP messagewill be given in afuture. 7.2.future version of this draft. 6.2. Indication tomaintainMaintain Privacy This document defines a privacy flag, which indicates that the user requires privacy for the SIP message. Without a privacy flag, intermediaries might add someuser-privacy-relatedprivacy-sensitive information in the message, even if a user agent had anonymized the message as perfectly as possible. When a user agent generates an anonymous message by itself according to the guidelines in Section7.1,6.1, it SHOULD set a flag to request intermediaries not to adduser-privacy-relatedprivacy-sensitive information. Note: The mechanism of the flag is FFS.8.7. Proxy Behavior When a proxy receives a SIP message containing a privacy flag, the proxy compliant with this specification MUST NOT add any information that may reveal something about the sender that is irrelevant to routing unless the proxy knows that such information will be deleted before it leaves the boundary of the Trust Domain[RFC3324]. A proxy MUST NOT modify the privacy flag, if present.9.8. Security Considerations TBD10.9. IANA Considerations TBD11.10. References11.1.10.1. Normative References [I-D.ietf-behave-turn] Rosenberg, J., Mahy, R., and P. Matthews, "Traversal Using Relays around NAT (TURN): Relay Extensions to Session Traversal Utilities for NAT (STUN)", draft-ietf-behave-turn-06 (work in progress), January 2008. [I-D.ietf-sip-gruu] Rosenberg, J., "Obtaining and Using Globally Routable User Agent (UA) URIs (GRUU) in the Session Initiation Protocol (SIP)", draft-ietf-sip-gruu-15 (work in progress), October 2007.[I-D.rosenberg-midcom-turn] Rosenberg, J., "Traversal Using Relay NAT (TURN)", draft-rosenberg-midcom-turn-08 (work in progress), September 2005.[RFC2119] Bradner, S., "Key words for use in RFCs to Indicate Requirement Levels", BCP 14, RFC 2119, March 1997. [RFC3261] Rosenberg, J., Schulzrinne, H., Camarillo, G., Johnston, A., Peterson, J., Sparks, R., Handley, M., and E. Schooler, "SIP: Session Initiation Protocol", RFC 3261, June 2002. [RFC4566] Handley, M., Jacobson, V., and C. Perkins, "SDP: Session Description Protocol", RFC 4566, July 2006. 10.2. Informative References [I-D.ietf-sipping-config-framework] Channabasappa, S., "A Framework for Session Initiation Protocol User Agent Profile Delivery", draft-ietf-sipping-config-framework-15 (work in progress), February 2008. [RFC3323] Peterson, J., "A Privacy Mechanism for the Session Initiation Protocol (SIP)", RFC 3323, November 2002.11.2. Informative References[RFC3324] Watson, M., "Short Term Requirements for Network Asserted Identity", RFC 3324, November 2002.[RFC4566] Handley, M., Jacobson, V.,[RFC4474] Peterson, J. and C.Perkins, "SDP:Jennings, "Enhancements for Authenticated Identity Management in the SessionDescription Protocol",Initiation Protocol (SIP)", RFC4566, July4474, August 2006. Authors' Addresses Mayumi Munakata NTT Corporation Phone: +81 422 36 7565 Email: munakata.mayumi@lab.ntt.co.jp Shida Schubert NTT Corporation Phone: +1 604 762 5606 Email: shida@ntt-at.com Takumi Ohba NTT Corporation 9-11, Midori-cho 3-Chome Musashino-shi, Tokyo 180-8585 Japan Phone: +81 422 59 7748 Email: ohba.takumi@lab.ntt.co.jp URI: http://www.ntt.co.jp Full Copyright Statement Copyright (C) The IETF Trust (2007). This document is subject to the rights, licenses and restrictions contained in BCP 78, and except as set forth therein, the authors retain all their rights. This document and the information contained herein are provided on an "AS IS" basis and THE CONTRIBUTOR, THE ORGANIZATION HE/SHE REPRESENTS OR IS SPONSORED BY (IF ANY), THE INTERNET SOCIETY, THE IETF TRUST AND THE INTERNET ENGINEERING TASK FORCE DISCLAIM ALL WARRANTIES, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO ANY WARRANTY THAT THE USE OF THE INFORMATION HEREIN WILL NOT INFRINGE ANY RIGHTS OR ANY IMPLIED WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. Intellectual Property The IETF takes no position regarding the validity or scope of any Intellectual Property Rights or other rights that might be claimed to pertain to the implementation or use of the technology described in this document or the extent to which any license under such rights might or might not be available; nor does it represent that it has made any independent effort to identify any such rights. Information on the procedures with respect to rights in RFC documents can be found in BCP 78 and BCP 79. Copies of IPR disclosures made to the IETF Secretariat and any assurances of licenses to be made available, or the result of an attempt made to obtain a general license or permission for the use of such proprietary rights by implementers or users of this specification can be obtained from the IETF on-line IPR repository at http://www.ietf.org/ipr. The IETF invites any interested party to bring to its attention any copyrights, patents or patent applications, or other proprietary rights that may cover technology that may be required to implement this standard. Please address the information to the IETF at ietf-ipr@ietf.org. Acknowledgment Funding for the RFC Editor function is provided by the IETF Administrative Support Activity (IASA).